PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B03141.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ZF-HD
Protein Properties Length: 281aa    MW: 29243.8 Da    PI: 7.4605
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B03141.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.93.7e-3161112557
     ZF-HD_dimer   5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                     rY+eClkNhA+ +GghavDGCgEfm++ geegt +al+CaAC CHRnFHR+e+
  Pahal.B03141.1  61 RYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGTLDALRCAACSCHRNFHRKES 112
                     8*************************9.999********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015664.8E-2961111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2461112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.4E-2961112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.61262111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.56E-21204278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-33206279IPR009057Homeodomain-like
TIGRFAMsTIGR015651.0E-26217273IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDFDDHDDGD EEMAPMPVSS SYETPPPLAA GFGGAPPKPP GEPVPLAKVA PGGHGGGGSG  60
RYRECLKNHA VGIGGHAVDG CGEFMAAGEE GTLDALRCAA CSCHRNFHRK ESPATEGSPV  120
SPAALVAYGA APHHQFSPYY RTPAGYFHHH QPLHMAAAAA AAAVPRPLAL PSTSHSGRDD  180
GDDLSGMAGP MSAVGPLSGM SLGGAGPSGS GGSGSGKKRF RTKFTPEQKD RMLAFAERLG  240
WRIQKHDEAA VQQFCDEVGV QRRVLKVWMH NNKHTLGKKP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-302182751875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1082461e-180AK108246.1 Oryza sativa Japonica Group cDNA clone:002-140-H06, full insert sequence.
GenBankAP0056761e-180AP005676.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1005_D12.
GenBankAP0149651e-180AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-180CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957068.11e-139PREDICTED: zinc-finger homeodomain protein 1
SwissprotQ6YXH51e-133ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
SwissprotA2Z2591e-133ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLK4A0V51e-136K4A0V5_SETIT; Uncharacterized protein
STRINGSi032496m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-62homeobox protein 22